Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074743-GRMZM2G074761
Species:maize
Duplication type:TD
Function (paralog1):alternative oxidase AOX3 precursor
Function (paralog2):transposon protein (LOC100281353), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.4185899808706
Log2 mRNA fold difference:-1.1600790054446
Log2 TE fold difference:1.5077204490845
Sequences
Protein sequence

MSSRMAGAALLRHLGPRLFAAGPAVSGLTARGGMPAAARLLPARMASTAAEAAREDAGAN
KRHGGTEKHEEEAAGGQSKKAVVSYWGIDTPKLVKEDGTEWKWTSFRPWDAYTSDTSIDI
GKHHAPTTLPDKAAYLIVKSLRVPMDLFFQRRHASHALLLETVAAVPGMVGGMLLHLRSL
RRFEHSGGWIRALLEEAENERMHLMTFLEVTQPRWWERALVLTAQGVFFNAYFVGYLLSP
KFAHRVVGYLEEEAVHSYTEYLKDLEAGIIDNTPAPAIAIDYWRLPADAKLKDVVTVVRA
DEAHHRDVNHFASDIHYQGMKLKDTPAPLSYH*

MSSRMAGAALLRHLGPRLFAAEPVTGLAARGVMPAAARILPARMSSTAAEAAKEAAAPQQ
RQKPEAAAAAPEGQDKKAVVSYWGIEPRKLVKEDGTEWRWFCFRPWDTYRADTSIDMKKH
HEPKALPDKLAYWLVKSLVVPKQLFFQRRHASHALLLETVAAVPGMVGGMLLHLRSLRRF
EHSGGWIRALLEEAENERMHLMTFLEVAQPKWWERALVLAAQGVYFNAYFVAYLASPKFA
HRFVGYLEEEAVHSYTEYLKDLEAGIIDNTPAPAIAIDYWRLPADARLKDVVAVVRADEA
HHRDVNHFASDIHYQGMKLRDTPAPLGYH*

Other information
Ka divergence:-0.566259KaKs divergence:-0.356023
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):999Length 2 (bp):990Length divergence:-0.005
MFE 1 (kcal):-483.36MFE 2 (kcal):-478.9MFE divergence-0.005