Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074781-GRMZM2G081502
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100273029
Function (paralog2):hypothetical protein LOC100273029

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.76082173565456
Log2 mRNA fold difference:-1.2161427174419
Log2 TE fold difference:0.52881047249041
Sequences
Protein sequence

MGNRHLCCLCLLLLLGLASGQVLFQAFNWESWKQSGGWYNLLMGKVDDIASAGVTHVWLP
PPSHSVSTQGYMPGRLYDLDASKYGTAAELKSLIAAFHGKGVQVVADIVINHRCADYKDA
RGIYCIFEGGTPDGRLDWGPHMICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQREL
TDWLLWLKSSDLGFDAWRLDFAKGYSPEVAKVYVDATAPTFAVAEVWNSMAYDGDNKPEY
DQDPHRQALVDWVDRVGGAASPATVFDFTTKGILNAAVEGELWRLIDPQGKAPGVIGWWP
AKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALV
AVRKRNGITPTSELTILEHDGDSYVAEIDGKVIVKIGSRYDVGHLIPAGFEVAAHGNDYA
VWEKAGAEQVTRA*

MAYDGDNKPEYDQDPHRQALVDWVDRVGGAASPATVFDFTTKGILNAAVEGELWRLIDPQ
GKAPGVIGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFD
WGFKDEIAALVAVRKRNGITPTSELTILEHDGDSYVAEIDGKVIVKIGSRYDVGHLIPAG
FEVAAHGNDYAVWEKAGAEQVTRA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):64GC content divergence:-0.008
Length 1 (bp):1302Length 2 (bp):615Length divergence:-0.358
MFE 1 (kcal):-591.4MFE 2 (kcal):-271.75MFE divergence-0.37