Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075003-GRMZM5G801241
Species:maize
Duplication type:WGD
Function (paralog1):mitochondrial import inner membrane translocase subunit Tim8
Function (paralog2):mitochondrial import inner membrane translocase subunit Tim8

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4553816090491
Log2 mRNA fold difference:0.93039230093646
Log2 TE fold difference:0.51028105262915
Sequences
Protein sequence

MDNPEMQRFIQKEQQKAMMNEMVGKLTSACWDKCITSAPGSKFSSGESTCLTNCAQRFLD
MSVLIAKRFEMQ*

MDNPEMQRFLQQEQQKAMMNEMVGKLTSVCWDKCITSAPGSKFSSGESTCLTNCAQRFLD
MSVMIAKRFEMK*

Other information
Ka divergence:-0.210026KaKs divergence:-0.338308
GC content 1 (%):56GC content 2 (%):54GC content divergence:-0.018
Length 1 (bp):219Length 2 (bp):219Length divergence:0
MFE 1 (kcal):-75.8MFE 2 (kcal):-67.6MFE divergence-0.057