Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075153-GRMZM2G113873
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100191523

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.74532467921055
Log2 mRNA fold difference:0.77403777727044
Log2 TE fold difference:-0.029794154163523
Sequences
Protein sequence

MSALEKAESTVFVASGMYAAVAMLSALVPAGGHIVTTTDCYRKTRIYMENELPKRGISMT
VIRPADMDALQNALDNNNVSLFFTETPTNPFLRCIDIEHVSNMCHSKGALLCIDSTFASP
INQKALTLGADLVIHSATKYIAGHNDVIGGCVSGRDELVSKVRIYHHVVGGVLNPNAAYL
ILRGMKTLHLRVQCQNDTALRMAQFLEEHPKIARVYYPGLPSHPEHHIAKSQMTGFGGVV
SFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAIMSYWDSKEQRDIYGIKDNLIR
FSIGVEDFEDLKNDLVQALEKI*

MATVSLTPQAVFSTESGGALASATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDC
PAARPHLGGGGEVSAIPNAKVAQPSAVVLAERNLLGSDASLAVHAGERLGRRIATDAITT
PVVNTSAYWFNNSQELIDFKEGRHASFEYGRYGNPTTEALEKKMSALEKAESTVFVASGM
YAAVAMLSALVPAGGHIVTTTDCYRKTRIYMETELPKRGISMTVIRPADMDALQNALDNN
NVSLFFTETPTNPFLRCIDIEHVSNMCHSKGALLCIDSTFASPINQKALTLGADLVIHSA
TKYIAGHNDVIGGCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNN
TALRMAQFLEEHLKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDS
VKIPYHAPSFGGCESIIDQPAIMSYWDSKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQ
ALEKI*

Other information
Ka divergence:0.340659KaKs divergence:0.165049
GC content 1 (%):46GC content 2 (%):52GC content divergence:0.061
Length 1 (bp):969Length 2 (bp):1458Length divergence:0.201
MFE 1 (kcal):-311.11MFE 2 (kcal):-529.11MFE divergence0.259