Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075223-GRMZM2G125512
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276488
Function (paralog2):hypothetical protein LOC100276831

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2263964064079
Log2 mRNA fold difference:-1.0013040321518
Log2 TE fold difference:-0.17102925011069
Sequences
Protein sequence

MSETAAPIGLSWAPKLPSFATTSGGSKIDHAPDPSTAQGSLWKRTSELVDGLFVPPRDPR
QLNKLARKNVKDTAGKGWFDMPAPTITPELKKDLEILQLRHVIDPKRHFKRAGKSKALPK
YFQVGTVVEPASEFYSSRLKNRERKATLVDELLSDQSLKSYRMRKVREIQEIRTPGGNQK
WKNKGKKTLKRAKDRRK*

MPETAAPIGLSWAPKLPSFATTSGGSKSDHAPNPSAAQGSLWNRASDLVDGLFVAPRDPR
QLNKLARKNVKDTAGKGWFDMPAPTITPELKKDLEILQLRHVIDPKRHFKRAGKSKALPK
YFQVGTVVEPASEFYSSRLKNRERKATLVDELLSDQSLKSYRMRKVREIQEIRTPGGNQK
WKNKGKKTLKRAKDRRK*

Other information
Ka divergence:0.348859KaKs divergence:-0.229841
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):594Length 2 (bp):594Length divergence:0
MFE 1 (kcal):-217.25MFE 2 (kcal):-219.6MFE divergence0.005