Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075244-GRMZM2G075461
Species:maize
Duplication type:TD
Function (paralog1):Cytochrome P450 CYP709C14
Function (paralog2):hypothetical protein LOC100279819

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.32363401369263
Log2 mRNA fold difference:0.3030102460376
Log2 TE fold difference:0.078344892475587
Sequences
Protein sequence

MGLAWMVTAAVAAVLASWAFNALVHLVWRPYAITRRLRAQGVRGPPYTFFTGSLGEIKRL
RAKGATVTLDVDDHDFIPMVQPHLRKWIALYGRTFVYWTGARPNVCVADVNVVRQVLFDR
TGLYPKNLMNPHISRLLGKGLVLTDGNDWKRHRKVVHPAFNMDKLKLMTATMSDCARSMI
SEWDAQLQKEESGRDGHGHGHVEEELSSRFEELTADVISHTAFGSSYSEGKRVFLAQRKL
QHIAFSTIFNVQIPALKYLPTEKNLRTRKLDRQVRAMLMDIIEARLASKDTAGGYGNDLL
GLMLEACAPPPEHHGEMAPTTLSMDEIVDECKTFFFAGHDTTSHLLTWASFLLSTHPEWQ
HRLRDEVRRECGDDEVPTGDALNRLKLVNMFLLETLRLYGPVSLIQRKAGSDLDLGGIRV
PEGAILTIPIATIHRDKEVWGEDAGEFRPERFENGVTRAAKHPNALLSFSSGPRSCIGQN
FAMIEAKAVVAMILQRFALELSPKYVHAPMDLITLRPRHGLPMLLKRL*

MGLAWMVAAAVAAVLASWAFNALVHLVWRPYAITRRLRAQGVRGPPYTFFTGSLGEIKRL
RGEGAAVTLDVDDHDFIPMVQPHLRKWIALYGRTFVYWTGARPNVCVADVNVVRQVLFDR
TGLYPKNLMNPHISRLLGKGLVLTDGDDWKRHRKVVHPAFNMDKLKLMTATMSDCARSMI
SEWDAQLQKEESGRDGHGHGHVEVELSSRFEELTADVISHTAFGSSYSEGKRVFLAQREL
QHIAFSTIFNVQIPALKYLPTKKNVRTRKLDRQVRAMLMGIIEARLASKDTAGGYGNDLL
GLMLEACAPPPEHHGEMALTTLSMDEIVDECKTFFFAGHDTTSHLLTWATFLLSTHPEWQ
HRLRDEVRRECGDDDEVPTGDALNRLKLVNMFLLETLRLYGPVSLIQRKAGSDLDLGGIR
VPEGAILTIPIATIHRDKEVWGEDAGEFRPERFENGVTRAAKHPNALLSFSSGPRSCIGQ
NFAMIEAKAVVAMILQRFALELSPKYVHAPMDLITLRPRHGLPMLLKRL*

www.000webhost.com

Other information
Ka divergence:-0.150754KaKs divergence:-0.429798
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):1587Length 2 (bp):1590Length divergence:0.001
MFE 1 (kcal):-717.24MFE 2 (kcal):-725.7MFE divergence0.006