Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075262-GRMZM2G027499
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383889
Function (paralog2):hypothetical protein LOC100275583

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASTEGFRLVRCPKCLNILPEPPNVTVYKCGGCGTTLRAKTRASGGQQVAATAKQGRQDS
DSYSVATAVSSGVPRQNRDQGSIGAVTESSFDADVASAEHGSNGARSGENGGGMLAGQNV
HFEGQDNNTSSRMEGPAGQTRLNANATYLDSGGTENHTVQQTAEKCRVSGHVDDTECHLN
TSEDEMFPSETSKAAVGMQDPGQKKEAGGTEHAANKKSHLVRALSRSCDLGSSMNLTDFH
SARASLQSKSFRASAPLQSKIMSTVDELKGDLSEMFSKPADCKPRPHPHPPRPSKRDGGR
TARAAVTSSAPLAAYRPPAEHSGYVSRSRLSRSAQVLPPPRRGLPSLRYRRHRVYPCHHS
VQMEVRSSCRHECCYNSCQPPCCRSCEQEPSAMHRAPVEQVKRRPPPRNHCLPVLSGAPF
VICSSCVSLVQLPADFAVPSRGARRLRCGACSELLSYSYRDPAGRKKPRSPFEGDECSTD
GYDEIRHQAAGAGFERAGPAVSYSEEYGLSFGIGHSTSSSTEDGQPLYVSRNSSFNTADD
GRMGRDGKLHRLMGYSSASELLRHSPDLFESFDRRAPSARAHVDGKGKGVCVAGNDAAGA
RDGAAKRSKARSGGLPLHGILKKGIHGLESLKLRS*

MANAEGFRLVRCPNCLNVLPEPHNVTVYRCGGCGTTLRAKICASGGRHASAKQARQDSDS
YSVATAVSNGNGAPPQIKDQGSESSFGADAPSTEHGSNGAGSGENGGGILAVQNAVVVAH
DAENKENHTVEQPTENSETCRAVSGHDDDTERRLNASEIKTVPSEMSKAAVSAQDPEQKE
EGGGEHAANKKGYLVRVLSRSCDLRSSRDSTDFQSARTSLQSKSFSASEPLQSKIMNTVD
ELKGDLSELFSNKPADDCKPKAHQPPRPSNSKQDGRTTRAAIASSAPLAAYHPAAKHSGY
VSRPSKSGQVAAASRGLPSLRYRRHWVYPFHFHHNVQTETRPCRHGCCHHSCQQPPCYRY
RPCKQEPAATRRPPVMVSNKRPPPPRNYCLPVLRGAPFVICSSCVSLVQLPAEFAVPSRG
TRRLRCGSCSEVLSYSYRDPGARKRLQSPFGGDEYSTDEYEQASGGHNAAAAGGFFGEAD
PVSYSEEYGLSFGIGHSTSTEDGQQPLYVSRNSSFNTVDERTGTRDGKLHRLMGYSSASE
VLQHSPDLFESFGRRAADAGRAHVGGKGKGVCVAENDACERDGGAVERSKVRSGGWPVHG
ILKKGIHGLESLKLRS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):1908Length 2 (bp):1851Length divergence:-0.015
MFE 1 (kcal):-802.52MFE 2 (kcal):-774.5MFE divergence-0.018