Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075637-GRMZM2G157019
Species:maize
Duplication type:WGD
Function (paralog1):nucleosome/chromatin assembly factor A104
Function (paralog2):LOC541933

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.84869355190705
Log2 mRNA fold difference:-0.71730432080543
Log2 TE fold difference:-0.12783566521048
Sequences
Protein sequence

MTAPADKGKKAKTDADGGEENEQIDGALVFSIEKLQEIQDELEKVNEEASDKVMEVEQKY
SEIRRPVYLKRGDIIKTIPDFWLTAFLSHPLLSELLTEEDQKIFKYLDSIDVDDSDVKAG
YSIYLNFSENPYFEDTKLTKTYSFVDDGTTTIKASQIKWKDGMGPANGNGINKKGNKRPL
VVESFFSWFSDTELKSLADGVQDEVAEIIKEDLWPNPLKYFNNEVEDEFEGDEEDDDDDD
DDDNLDGDDNDDDGDQEN*

MTAPADKGKKAKTDADGGEENEQIDGVLVLSIEKLQEIQDELEKVNEEASDKVMEVEQKY
SEIRRPVYLKRGDIIKTIPDFWLTAFMSHPLLSELLTEEDQKIFKYLDSIDVDDSDVKAG
YSIHLNFSENPYFEDTKLAKTYIFADDGTTTIKASEIKWKEGMGPANGNGINKKGSKRPL
VEESFFSWFGDTELKSLADGVQDEVAEIIKEDLWPNPLKYFNNEVDDEFEGDEDDDDLDG
DDDDEGDDLEN*

Other information
Ka divergence:-0.131307KaKs divergence:-0.27687
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):777Length 2 (bp):756Length divergence:-0.014
MFE 1 (kcal):-228.5MFE 2 (kcal):-211.19MFE divergence-0.039