Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075683-GRMZM2G162637
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217181
Function (paralog2):hypothetical protein LOC100279946

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.71884743166597
Log2 mRNA fold difference:-0.44168260658423
Log2 TE fold difference:1.1550431537672
Sequences
Protein sequence

MEHVIGGKFKLGKKIGSGSFGELYLGVNVQSGEEVAIKLESVKSRHPQLHYESKLYMLLQ
GGTGIPHLKWFGVDGEYNVMVIDLLGPSLEDLFNYCNRKFSLKTVLMLADQMISRVEYMH
TRGFLHRDIKPDNFLMGLGRKTSQVYVIDYGLAKKYRDLQTHRHIPYRENKNLTGTARYA
SVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTSIEAL
CKSYPSEFVTYFHYCRSLQFEDKPDYSYLKKNFRDLFIREGCQPDYVFDWTVSRQAADNN
RLRLSGKTGGLVGPSVDRAERAAAKQDVPHRFTGPADALAKRTGSGSGHYGEHTKHRTLL
DSLMASNMGVDSDKRRHSSSRNGSTSRKALLSSNRGSGDPSEPNRSSHLVPTTTSSSRPS
TNQRLHHSTGLEGRTPSFPKPGRIGYDDPTMRSFERLTISAERRK*

MEHVFGGKFKLGKKIGSGSFGELYLGVNIQSGEEVAIKLESVKSRHPQLHYESKLYMLLQ
GGTGIPHLKWFGVDGEYNVMVIDLLGPSLEDVFNQCNRKFSLKTVLMLADQMITRVEYMH
TRGFLHRDIKPDNFLVGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTSIEAL
CKSYPSEFITYFHYCRSLRFEDKPDYSYLKKNFRDLFIREGYQLDYVFDWTVSRQAVDNN
RLRLSGKTGGLVGPSVDRAERAAARQDVPDRFTGQAGAFARRTGSGSGQYGEHTKHRTLL
DSLMASKMAVDSDKRKHSSSRNGSTSRKALLSSSRGSGDPSDPNRSSHLVPTTSSSSRPS
TNQRLHQSTGLEGRTSSFPKPGRIGQDDPTMRSFERLTISAERRR*

Other information
Ka divergence:-0.0937333KaKs divergence:-0.202431
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1398Length 2 (bp):1398Length divergence:0
MFE 1 (kcal):-413.24MFE 2 (kcal):-416.5MFE divergence0.004