Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075701-GRMZM2G126682
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192647
Function (paralog2):24-methylenesterol C-methyltransferase 2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.8804676254001
Log2 mRNA fold difference:-1.4678915754407
Log2 TE fold difference:-0.38594703051984
Sequences
Protein sequence

MEAATMAWTAAVVGAGLVYWFVWVMGAAEVKGKRAVDLKMGSITRDKVQDKYTQYWSFFR
RPKETATTAASAEKVPAFVDTFYNLVTDIYEWGWGQSFHFSPSLPGRSHRDATRVHEERV
ADLLGARPGHRLLDVGCGVGGPMRAIAAHSGSDVVGITINEYQVKRARAHNRKAGLDSPR
CEVVCGNFLSMPFPDASFDGAYSIEATCHAPRLQDVYGEVYRVLKPGRLYVSYEWVTTPL
YHAEDPGHVECVHGIERGDALPGLRRQDEIAAIAKEAGFEVLKEQDLALPPALPWWTRLK
MGRIAYWRNSIVVRVLTLLRIAPKGVSEVHEMLYETAQHLTRGGETGIFTPMHMVLLRKP
PAAASTEEEAK*

MEAATMVWTAAVVGAGLVYWFVWVMGAAEVKGKRAVDLKMGSITRDKVQDKYTQYWSFFR
RPKETATTAASAEKVPAFVDTFYNLVTDIYEWGWGQSFHFSPSLPGRSHRDATRVHEERV
ADLLGARPGHRLLDVGCGVGGPMRAIAAHSGSNVVGITINEYQVNRARAHNRKAGLDSPR
CEVVCGNFLSMPFPDASFDGAYSIEATCHAPRLQDVYGEVYRVLKPGGLYVSYEWVTTPL
YRAEDPDHVECIHGIERGDALPGLRRQDEIASIAKEVGFEVLKEQDLALPPALPWWTRLK
MGRIAYWRNSLVVRVLTMLRVAPKGVSEVHEMLYETAQHLTRGGETGIFTPMHMVLLRKP
AAAASTEEAN*

Other information
Ka divergence:-0.439386KaKs divergence:0.139665
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1116Length 2 (bp):1113Length divergence:-0.001
MFE 1 (kcal):-580.11MFE 2 (kcal):-566.74MFE divergence-0.012