Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075712-AC233899.1
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100303821
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRRSEWEDRCKRHPEHRTSKGVCPYCLRDRLAHLSASSSATTTTRASSSSAPTSPCSSGG
SSPPPQYRAALSADVSSVHVVVAGSSFADVAAFSQPLMPTSANKKPPPASQDEPARGKGE
AKRRKSGKKKKIGRFLSRLVGAERRRHTGDGGGDGDGAELFHSRTMKEKTASKWVFF*

MAAWVSCLHLWPLSLSLSLSLSTPSLTPVLQSCSARKEIGITANSFVRATRLLLFQDPCR
SLTIESPPFPNPFQSSAAKCRSQMKRQSKRPTASRDSPETGTVDKQLALAESLTARKTEP
DELGEKKRRLAPDQVRALERCFEADNRLDPDRKARVARDLALNPRQVAVWFQNRRARWKA
KALHRDFAALRARHDALRRDKDALAAEIRELRQKLAEPAAVKTEATGSDTAEARPTTTTT
AGAPAPPAGGCKDGSSDSDSSVVLNDDVDASPYSGAAFEQPGAFAGFGAPFLAASAAAAP
PPTGCSSPPVFETKWQHGPTTYAFESYKSCCAGYGFTEEWLASSDVVGSDGAAGFFSEDH
ASSLNFSWCASGAQDWE*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):68GC content divergence:-0.022
Length 1 (bp):534Length 2 (bp):1134Length divergence:0.36
MFE 1 (kcal):-253.1MFE 2 (kcal):-554.4MFE divergence0.373