Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075719-GRMZM2G169694
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274535 (LOC100274535), mRNA
Function (paralog2):ras-related protein Rab-6A

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.89294845540787
Log2 mRNA fold difference:-0.4097777754719
Log2 TE fold difference:-0.45895302528475
Sequences
Protein sequence

MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL
QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIDEVRTERGSDVIIVLV
GNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFNIKALFRKIAAALPGMETLSSAK
QEDMVDVNLRSGNANSSQSQAQAGGCSCYSPSLSYSTIVSLLLYPIYHYRVFCRVTVFRT
VLSCFCRDS

MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL
QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV
GNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFNIKALFRKIAAALPGMETLSSAK
QEDMVDVNLRSGNANSSQSQAQAGGCSC*

Other information
Ka divergence:-1KaKs divergence:-0.995763
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):747Length 2 (bp):627Length divergence:-0.087
MFE 1 (kcal):-234.8MFE 2 (kcal):-205.2MFE divergence-0.067