Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075794-GRMZM2G470103
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.0600020015786
Log2 mRNA fold difference:0.69966210684283
Log2 TE fold difference:0.4761138110539
Sequences
Protein sequence

MGVKLDRSLVAVVRSAGNSSLLQGQGCLFQLAFGKLKWDGNKFPGLGRQCKQVQDQDSES
WNCTRFSRLIRVSRPNVLIPFESGLAVDRMEWRFLEWKGLTILKGHTSAMARGRARLQLQ
EGSAGCRQQPIYNSRGAHVPGGRKLTPRDPAPDPVSSSQSLLREEPKMLLLRASTPFAYA
KVDKVDAEEARHLRAQFLIHKVLEKKSPRPSALARARPRIGVRLKKLRLAVRALRARACR
ALQRHLGNLRRLVGRGGVQGSP*

MLLLRASTAPFAYAKVDKVDAEEARHLRAQYLIHKVLEEKSPRPPAALARTSRPRVGVRL
KKLRLAVRGLRARACRALLRHLRNLRRLVGHGAQGSP*

Other information
Ka divergence:0.0776908KaKs divergence:0.999904
GC content 1 (%):62GC content 2 (%):72GC content divergence:0.075
Length 1 (bp):789Length 2 (bp):294Length divergence:-0.457
MFE 1 (kcal):-356.54MFE 2 (kcal):-150.1MFE divergence-0.407