Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G075978-GRMZM2G450055
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216891
Function (paralog2):hypothetical protein LOC100304310

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.83811190915757
Log2 mRNA fold difference:-1.8982627785973
Log2 TE fold difference:1.0359797523761
Sequences
Protein sequence

MSGWDEGAVFYSDQAQFPRGGPGGDPAADLTRHSALRKFKEFLRGFTGPTGDFPYRESLV
HNRDHVTVAIEDLDAFDAELSDKIRKSPADYLPLFETAAAEVLASLRSKVAGETGEMEEP
VTGDVQIFLSSKENCLSMRSVGADYMSKLVKIAGIAIAASRVKAKATHVTLICKNCRSVR
TVPCRPGLGGAIVPRSCDHVPQPGEEPCPLDPWIAVPDKSKYVDLQTLKLQENPEDVPTG
ELPRNVLLSVDRHLVQTIVPGTRLTVVGIYSVYQASTTQKGAVGVKQPYIRVVGLEQSRD
NNSNGPSNFTLDEEMEFKEFAQRPDAYAKLCSMIGPSIYGHSDVKKAIACLLFGGSKKRL
PDGVRLRGDIHVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVTRDSSSR
EFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVL
AAANPIAGRYDDLKTAQDNIDLQTTILSRFDLIFIVKDIRMYDQDKRIASHIIKVHASGA
AASSTNTEGSEGENWLKRYIEYCRATCKPRLSEKAAEMLQNKYIEIRQKMRQQAHETGRA
AAIPITVRQLEAIIRLSESLAKMRLTSVATPEHVEEAFRLFNVSTVDAARSGINEHLNLS
PEIANEIKQAEAQIKRRMGIGSHISERRLIDDLNRMGMNESIVRRALLIMHQRDEVEYKR
ERHVIVRKA*

MSGWDEGAVFYSDQAQFPRGGPGGDPAADLTRHSALRKFKEFLRGFTGPTGDFPYRESLV
HNRDHVTVATEDLDAFDAELSDKIRKSPADYLPLFETAASEVLASLRSKVAGETGEMEEP
VPGDVQIFLSSKENCLSMRSVGADYMSKLVKIAGITIAASRVKAKATHVTLICKNCRSVR
TVPCRPGLGGAIVPRSCDHVPQPGEEPCPLDPWIAVPDKSKYVDLQTLKLQENPEDVPTG
ELPRNMLLSVDRHLVQTIVPGTRLTVVGIYSVYQASTTQKGAVGVKQPYIRVVGLEQSRD
NNSNGPSNFTLDEEMEFKEFAQRPDAYAKLCSMIGPSIYGHSDVKKAIACLLFGGSKKRL
PDGVRLRGDIHVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVTRDSSSR
EFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVL
AAANPIAGRYDDLKTAQDNIDLQTTILSRFDQIFIVKDIRMYDQDKRIASHIIKVHASGA
AASSANTEGSEGENWLKRYIQYCRATCKPRLSEKAAEMLQNKYIEIRQKMRQQAHETGRA
AAIPITVRQLEAIIRLSESLAKMRLTSVATPEHVEEAFRLFNVSTVDAARSGINEHLNLS
PEIANEIKQAEAQIKRRMGIGSHISERRLIDGLNRMGMNESIVRRALLIMHQRDEVEYKR
ERHVIVRKA*

Other information
Ka divergence:0.759473KaKs divergence:0.589565
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):2190Length 2 (bp):2190Length divergence:0
MFE 1 (kcal):-743.85MFE 2 (kcal):-745.3MFE divergence0.001