Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G076062-GRMZM2G330019
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383598
Function (paralog2):hypothetical protein LOC100383150

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.110282370672
Log2 mRNA fold difference:0.2382961574492
Log2 TE fold difference:-1.3466716414406
Sequences
Protein sequence

MAAVAPPPAPAPAPVPAPAPATVPVADQTTDLLQKLSLDSQPKAADATQPAAATAKKQGA
AASQPLSVAIPPEPSITPVIQDFTDPNLFYLPAYYYGGYDSSMSEWDDYPRYLNSDGVEI
APAVYGDIYGYGYAPYGAYSPATSPVPTVDGQMFGAQHYQYPTAYFQPPTPVPSTTQSDL
QSSKNPEKPAAKADPAKTTNGVPNGTAHSNSGTVPLASSQQNSSLTPDGTYRAPLLGGVP
SAGYLDTTYGYDSTGAHFAWYDGSAYANGQQRATTTNHFPSSTFGNGSPARYQNKSTTTP
QMGMQNRRPTTTSPAPTYPNRMYPSSRPYTQYGNSIKTGLPYGSNGYDSRIYGRWGLGMD
NRYRPRGRNGYYGYGNESQDGTIELNRGPRSGRFKNQKLYGHTVTIAVKGQSLPSGESKD
DSAVPDRAQFNRDDFPVQYDAAKFFVIKSYSEDDIHKSVKYNVWASTTNGNKKLDAAYQE
AQSKGSACPIFLFFSVNTSGQFVGVAEMTGAVDFEKTLGYWQQDKWNGSFSVKWHIVKDV
PNNILKHIILENNENKPVTNSRDTQEIHLEQGLQMLKIFKEHVSKTSILDDFAFYESRQK
LMQDKRSKQQQVQKQVWDSRTPISVTGSEQQQEAANGKPNPSVPNGVPAEVKAAKASAEN
GTATPAISYAAKVAQAATEKPVLANGVAKTG*

MAAVATPPAPAPAAPAPAPAPAAAPAPVTVAPAADQTTDLLQKLSLDSQPKAAGATEPAA
AAAKEGAVTSQPLSVAIPPERSITPVLQDFMDPNLFYLPAYYYGGYDSSMSEWDDYPRYL
NSDGVEIAPAVYGDIYGYGYAPYGAYSPATSPVPTVDGQMFGAQHYQYPTTYFQPPTPIP
STTQSNLQSSNNPEKPAAKADPAKATANGVPNGTGHTHSYSGTVPSQQSSALTPDGTYRA
PLLGGVPSAGYLDTTYYGYDSTGAQFAWYDGSAYANGQQRTTTTNRFPSSSFSGNGSSAI
YQNKSSTTQQMQGMQNRRPTTTSAAPTYPNRMYPSPRPYTQYGNSVKTGLPYGSNGYDSR
IYGRCGLGNGMDNRYRPRACSGYYGYGNESQDGTIELNRGPRSGRFKNQKLYGHTVTIAV
KGQSLPSSESKNDSAVPDRAKYNRDDFPVQYDAAKFFVIKSYSEDDIHKSVKYNVWASTT
NGNKKLDAAYQEAQSKGSACPIFLFFSVNTSGQFVGVAEMTGAVDFEKTLEYWQQDKWNG
SFSVKWHIVKDVPNNILKHIILENNENKPVTNSRDTQEIRLEQGLQMLKIFKDHVSKTSI
LDDFAFYESRQKLMQDKRSKQQQLQKQVWDTRTPVSVTGERPQEPANGKPNPSVPDGVTA
EVKAVKAPAENGITAPVVSYAAKVAQTAPEKPVLSNGVAKTG*

Other information
Ka divergence:0.043468KaKs divergence:0.402492
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):2076Length 2 (bp):2109Length divergence:0.008
MFE 1 (kcal):-709MFE 2 (kcal):-720.48MFE divergence0.008