Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G076239-GRMZM5G853854
Species:maize
Duplication type:TD
Function (paralog1):hydroxyacid oxidase 1
Function (paralog2):hypothetical protein LOC100192687

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:3.178529541186
Log2 mRNA fold difference:2.2005023709825
Log2 TE fold difference:0.99497043798826
Sequences
Protein sequence

MALITNVSDYEELAKQKLPKMVYDFYAGGAEDQWTLKENKEAFSKILFRPRVLIDVSHID
MSTSILGYKISMPIMVAPTALHKLAHQEGEVASAQAAAAAGTIMTLSSWSSCSIEEVSSI
APGLRFFQLSVFKDRDIVQQLVRRAENAGYKAIAVTVDAPRLGRREADVRNRFRLPENVV
LKCFEGLDLSKMDKTKGSGLAAYATSQIDSSLSWKDIKWLQTITGLPILVKGVITAEDAR
IAIECGVAGIIVSNHGGRQLDYLPATISCLEEGKLQVVREAKGRRVPVFLDGGIRRGTDV
FKALALGASGVFIGRPVLFALAVDGRAGVRNALRMLRDELEITMALSGCASLKDITRDRV
ITERDMIRRSRI*

MRPLCSNPPLHSKSHGGSHRSLARLRFPCSLGMELITNVTEYEKLAKERLPKMVYDYYAS
GAEDQWTLKENREAFSRILFRPRVLIDVSRIDMATNILGFSISMPIMIAPSAMQKMAHPD
GELATARAAASAGTIMTLSSWSTSSVEEVNSVGPGIRFFQLYVYKDRNIVRQLVKRAEMA
GFKAIALTVDTPILGRREADIKNRFALPPHLVLKNFQALDLGTMDKTNDSGLASYVAGQV
DRTLSWKDVKWLQTITSLPILVKGIVTAEDTRLAIEYGAAGIIVSNHGARQLDYVPATIS
CLEEVVREAKGRLPVFLDGGVRRGTDVFKALALGASGVFIGRPVLFSLAVDGEAGVRKVL
QMLRDELELTMALSGCTSLREITRAHVITDSDRIGRSRL*

Other information
Ka divergence:-0.479929KaKs divergence:-0.550206
GC content 1 (%):52GC content 2 (%):57GC content divergence:0.046
Length 1 (bp):1119Length 2 (bp):1200Length divergence:0.035
MFE 1 (kcal):-415.49MFE 2 (kcal):-481.54MFE divergence0.074