Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G076263-GRMZM2G145962
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284221
Function (paralog2):ribosome-like protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.6439112077098
Log2 mRNA fold difference:2.6737763369876
Log2 TE fold difference:0.032613798776475
Sequences
Protein sequence

MAAPATTSLLSTLLNLPLAPLSGKSSPPSVVHVARRGPMVVVAAKGYNVQILVDENEGEE
SIFRRFRREVMRAGVLQEIKRRRRYESKTDEKKRKAREAGRRNRRRRMMDEPRFPEEDAD
ATAKARDEDDDNWEIDGIL*

MAAPATSSLLSTLLQLPLAPFSGKSSPPSVVHVARRAPTAVVAAKGFNVQILVDENEGEE
SIFRRFRREVMRAGVLQEIKRRRRYESKTDEKKRKAREAGRRNRRRRMMDEPRFPEEDAD
ATSKARDEDNDNWEVDGIL*

Other information
Ka divergence:-0.012229KaKs divergence:-0.345004
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):420Length 2 (bp):420Length divergence:0
MFE 1 (kcal):-185.4MFE 2 (kcal):-187.5MFE divergence0.006