Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G076778-GRMZM2G063747
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276620
Function (paralog2):hypothetical protein LOC100276711

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPCLAQEFHPKLPAANHYCKSLSSLIRETYAHCHVPCVGIAGWSSGGDSDDDSVLDEARD
TKQVILSEMRSRQMKRRSRCSVDSPTPLPLPSSSSAFAWSYSYAPLGPRTVLDELSSPKT
CVVVEGAAVADDDDGDVYCDADDESEAFFSVKSCFTRSTSPSPSRAATAASSPRMMTGPS
PPMLRRSPEAWERFRDCDGWPFGLCRRPAVLPLLPPLPSTPADSWKWRKSVSTVASPRRR
SPTPAYRHKAATAATLAVNDRAAASGLRA*

MPCLAQEFHPKLPAASHYCKSLSSLIRETYAHCHVPCVRTPAGAGWSSGEDSDDDNVLDE
AQDTKQVILHEMRSRQMKRRSRCGVDVDSPTLPLSSSSAFAWSYTPLDPRTVLDTVSSPK
TCTCVVVEGTAAEEEQEEEAADGGDCDADDESEAFFSVKSFFTRSTSRAATVASSACMLT
DPPPPTLRSPEAWERFRDCEGWPFGLCRRPRPAVLPLPPLPSTPADSWKWRKSVGSLAAS
PAPAYRHKITTAAPASSK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):68GC content 2 (%):67GC content divergence:-0.007
Length 1 (bp):810Length 2 (bp):777Length divergence:-0.021
MFE 1 (kcal):-386.44MFE 2 (kcal):-371MFE divergence-0.02