Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G076844-GRMZM2G018027
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEAYVLFAPAKEVIRFEEQEEDIGCPSESSAARSTSSSSSSSDGVDLADDASSSGSSCHF
EMASLMTQLPIKYVRRTHVLADGAGIAAALLPDYRDLILAGVLWSDAALLLFGCAGGACP
SSSTASRSRSRRWRRSAASRTCPSRRRSGSRRRGAAASASRTRTAVALPPRPAGSRRPGL
G*

MEAYVLFARAKEQEEDIGCPSESSAARSTSSSSDGVDLADDASSSGSTCHFEMASLMTHL
PIKRGLSKFFAGKSQSFASLAAVGGIDDLPKPPAKRLKTSWSCGVGLEDARRGPPSVTTA
NKQASSRARLTPSALGSTPRRLVRARPLVTARPEAAAGKPLLFA*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):70GC content divergence:0.022
Length 1 (bp):546Length 2 (bp):495Length divergence:-0.049
MFE 1 (kcal):-273.2MFE 2 (kcal):-257.8MFE divergence-0.029