Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G076868-GRMZM2G120839
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.2779352456328
Log2 mRNA fold difference:-1.4953040369347
Log2 TE fold difference:1.1044819276163
Sequences
Protein sequence

MTPRPRLLLLLLPLLQPLALLLAIAVPAACAASTLAVSASSASPTVCGVAELSGTVHCAA
LQGASISNASSGPVAPSAIAFAELSAGRGFVCGLQAGGAALFCWPSTPAPRWGQLRRLYD
GPAPLADLAAGADHVAAYDASGSGSGTVLWWRGGGRFPARADGAFRSLVSGDGFSCAVEA
SAPAAVRCWGPRGGALQAGLANASAAPCLAAGGDRACAVLASGTALCSGAPAANASAAAP
PGDLFGYGLAVGDSHACALRRPYHTAVCWSLGGPTTTLYEPALGISFEFLVAGGNFTCGV
ASSDFSVYCWSVGAVAAPVPLPRIRPGVCVADDTACRGCGFMPQSQQFCGGSGGICDALC
DGSPPLPPAPPPPPPRTPPPSSSRRVSKAWIAFCVVGAAGGFAGLCSIVYCLVFGFCSNK
RVHNSVQPNISAAADNNHNHNSGVVGGSPYGSPNGSRARGLFRRQLSRAMTRQRSGPSSF
KDAAEEFTFAQLEAATKGFALEARIGEGSFGTVYRGKLSDGREVAIKRGECGPRAHRFQE
KESAFRSELAFLSRLHHKHLVALVGYCEENEERLLVYEYMKNGALYDHLHPKASAAPSPV
ASSWKLRIKILLDASRGIEYLHSYAVPPIIHRDIKSSNILLDGGWMARVSDFGLSLMGPL
EPAPSEDDAAAAAWRSRSRSRSQHLTVVKAAGTVGYMDPEYYGLHHLTVKSDVYGFGVVM
LESLTGRRAIFKSGEGGSPVSVVDYAVPSIAGGELGKVLDPRAPEPAAHEAEAVELVAYT
AVHCVRLEGKDRPAMADVVANLETAFALCEGSAGGGVGVGNSSSSASLSVTSMDRSGALA
*

MTPRPRLLLLLLAIALPAASAASTLAVSASSTSPTVCGVAEPNGTVYCAPLQGPSSSNSA
SPVAPSAIAFAELSAGRGFVCGLQAGGAALFCWPSTPAPQWGQLRRLYNGPAPLADLAVG
GGHVAAYDASGKVVLWWRGGGRFPARADGAFRSLVSGDGFSCAVQANASAAVRCWGPQGS
AVQAGLANASAAPYLAAGGARACAVLASGAALCSGSDASAGALPRDLFGYGLAVGDSHAC
ALRRPDHTAVCWTLGGPTTTLYEPALGISFAFLVAGGNFTCGVASSDFSVYCWSAGAVAA
PVPLPRIRPGVCVSDDSSCRGCGFMSQSQKFCGGSGGICDALCDDSPPPPAPAPPSPPPS
SSRRVSKAWIAFCVVGAVGGFAGLCSIVYCLVFGFCSNKRVHNSVQPNISAAAAGTGADN
NGGGGGAAASGSPYGSPNGSRARGLFRRQLSRAMTRQRSGPSSFKDPAEEFTFAQLEAAT
KGFALEAKIGEGSFGTVYRGKLPDGREVAIKRGESGPRARRFQEKESAFRSELVFLSRLH
HKHLVGLVGYCEEAEERLLVYEYMKNGALYDHLHPKASAAPSPVASSWKLRIKILLDASR
GIEYLHSYAVPPIIHRDIKSSNILLDGGWTARVSDFGLSLTGSPEPSSEESRSQQLAVTT
KAAGTVGYMDPEYYGLHHLTVKSDVYGFGVVMLESLTGRRAIFKEAEGGSPVSVVDYAVP
SIMGGELGKVLDPRAPEPAAHEAEAVELVAYTAVHCVQLEGKDRPAMADIVANLETAFAL
CEGSDRDRGTGAFGNSSSSASLSVTSMDRSGALA*

Other information
Ka divergence:-0.330601KaKs divergence:-0.267148
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):2523Length 2 (bp):2445Length divergence:-0.016
MFE 1 (kcal):-1409.74MFE 2 (kcal):-1369.52MFE divergence-0.014