Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G076946-GRMZM2G077015
Species:maize
Duplication type:TD
Function (paralog1):dhurrinase-like B-glucosidase
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.43844903971095
Log2 mRNA fold difference:-0.1569848981134
Log2 TE fold difference:0.69413809024338
Sequences
Protein sequence

MAPLLLASRTACHPGLTSSRHDNGRHGLSSSPGSSSKRSRSLSFIPRAEKTTTGGEGHVV
SEKLSPWQIPRREWFPPSFIFGAATSAYQIEGAWNEGGKGPSTWDDFCHKYPEWIADGST
GDVGANSYYLYREDVRLLKEMGMDAYRFSIAWSRILPKGTLEGGINHKGIEYYKRLINLL
KENGIEPYVTLFHWDTPQALVDSYGGFLDDRIVKDYTDFAKVCFVHFGDTVKNWFTFNEP
QTFSSFSYGTGIFAPGRCSPGQKCANPTGNSLTEPYIVAHNLLRAHAETVHEYNKHYRGN
KDAQIGIAFDVMGRVPYDNMFLDDQAQERSIDYNLGWFMEPVVRGDYPFSMRSLIKDRLP
YFTDDEKEKLVGSYDIMGINYYTSRFSKHIDISPKYSPVLNTDDAYAAQETKGPDGNTIG
PSMGNPWIYMYPNGLKDILMFMKNKYGNPPVYITENGIGDVDTKDKPLPIKDALNDHVRL
DYLQRHISVLKDAIDLGADVRGHFTWSLLDNFEWSAGYTERYGIVYVDRGNGCKRRMKRS
AKWLKKFNRAAHTKKKDMTGIIPPSAY*

MAPLLLASRTACRPGLTSRHAHDNGRHGLSSSPPGSRSKRSRSLSLRPRAEKTTTGGGGH
VVSEKLSPWQIPRREWFPPSFIFGAATSAYQIEGAWNEGGKGPSTWDDFCHNHPEWIADG
SSGDVGANSYYLYREDVRLLKEMGMDAYRFSISWPRILPKGTLEGGINHKGIEYYKKLIN
LLKENGIEPYVTLFHWDTPQALVDSYGGFLDDRIVKDYTDFAKVCFVHFGDVVKNWFTFN
EPQTFSSFSYGTGICAPGRCSPGQKCANPVGNSLTEPYIVGHNLLRAHAETVHQYNKYYR
GNKEGHIGMAFDVMGRVPYEKMFLDDQAQERSIDYNLGWFVEPVVRGDYPFSMRSLVKDR
LPYFTDEEKEKLVGSYDIMGINYYTSRFSKHVDISTGYTPVLNTDDAYATQETKGPDGNT
IGPSMGNSWIYMYPNGLKDILMVMKNKYGNPPIYITENGIGDIDSKEKPLPVKDALNDHA
RLDYLQRHISVLKDAIDLGADVRGHFTWSLLDNFEWCGGYTERYGIVYVDRSNGCKRRMK
RSAKWLKKFNRAAHSKKKDKTGIIPPPSAY*

Other information
Ka divergence:0.0272062KaKs divergence:0.0564746
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1704Length 2 (bp):1713Length divergence:0.003
MFE 1 (kcal):-580.8MFE 2 (kcal):-609MFE divergence0.024