Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077002-GRMZM2G421212
Species:maize
Duplication type:WGD
Function (paralog1):GATA transcription factor 29
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.23283422463379
Log2 mRNA fold difference:-0.014447845964
Log2 TE fold difference:-0.25051214175125
Sequences
Protein sequence

MGKQGPCRHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGSLANYTPMHRKDDIDDDEPR
VSKLKPPTSKLKSQKKKPNHIIMENGPFSGQNFRKMGDVDQSYRSSSGSAVSYSESCAPY
GAADASEMTGSAQSHAWESLVPSRKRSCVTRPKPSPVEKLAKDLNFIMHEEQLYYPSGSS
EEDLLYHSETPVGSFEMGSGSVLLRHPNSKSLEKESEASSIPADNKSYITSESYSGSASF
AIHNGNKAAINLNASNARLKKSPLHMEDNARRGVGSISGPEGFTKSTMKPLKRPRDTQFQ
IDAELEGTMRSPLRGLKSGALAQFESSSLPKSGYTTKDSTCTGGALNLFMLPPEKLLVVP
PQYVDPDQDLLLEIPLNARHPEAELLCQPSQLMSSISRSSTSMGGVAEGEGCLKQP*

MGKQGPCRHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGSLANYTPMHRNDNIDDDEPR
VSKLKPPTSKLKSQKKKTNHIIMENGPFSGQNFRKMGDVDPSYRSSSGSAVSYSESCAPY
GAADASEMTGSAQSHAWESLVPSRKRSCVTRPKPSPVEKLAKELNYIMHEEKLYYLSESS
EEDLLYHSETPIGSFEIGSGSVLLRHPNSKSLEEESKTSSIPADNKSYITSESYSDSASF
VVHSGNKAAINLNLPTARPKKSPLHMEDNARRDKLHYENQHVLESVDSPLVSVDLEDVIN
YTNFMKYLTKEDRRQLLKFLPPVDSLTPPESLRSMFSCIQFSDAIDSYQMLLREGILDPS
LCGDEEWKKVKTLALTNLTKCSWLECYKQKKGAKETGGVGGISGPEGFTKSTMKPLKRPR
DTHFQSDAELDGTMRSPLRVLKSGALALQFESSSLPKSGYATEDSTCTGGAPNLFMLPLE
KLPLLVPSQYAVSDQDLLLEIPLNARHPEAELLCQPSQLMSSITSSSTSMGGVAEGEGYL
KQP*

Other information
Ka divergence:0.113022KaKs divergence:-0.123493
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1251Length 2 (bp):1632Length divergence:0.132
MFE 1 (kcal):-402.4MFE 2 (kcal):-512MFE divergence0.12