Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077127-GRMZM2G008751
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284268
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRMNMMPTESIHPSRFDQPNLWKQFEFVLKFRAQVPERPRLPRRVRAAGDPAGVRRDGGQ
LLGVGDRVRPAGGGRGRAGGGAGVQPHPVQHAAGHLPPRVPHRVQHRPPRRAGHGAVPLR
GGADHPRRLRPGLRRRLPQGPPRRPHRRRVPPDRGPPPAPQRPRPPRAGAPPRARPVLAE
RLPPTVLVVIGIFYRLDLPRAETGDGDQIMWRPAPFAVRAMTVDCSTSVRLVLDFWYPIF
LLLFNGEPSSSTGTPHLALFSCTSTQVLVGLLATRGEYSRRCTSSVQIRLRLVLPATFVI
LLLVVYCYENMR*

MLRSTHPPSPSSGSSDATMVGGGAPSGAKLLQILNVRVVGSGDRVVVLSHGFGTDQSAWS
RVLPYLTRDHRVVLYDLVCAGSVNPEHFDFRRYDTLDSYVDDLLAILDALRVSRCAFVGH
SVSAMIGILASIRRPELFAKLVLIGASPRFLNDHDYHGGFELPEIQQVFDAMAANYSAWA
TGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCRTVFNTDLRGVLGMVRAPCVVVQTT
RDVSVPASVAAYLKAHLGGRTAVEFLQTEGHLPHLSAPGLLAQVLRRALARY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):71GC content divergence:0.068
Length 1 (bp):939Length 2 (bp):879Length divergence:-0.033
MFE 1 (kcal):-390.84MFE 2 (kcal):-423.3MFE divergence0.04