Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077147-GRMZM2G455869
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.085381964520052
Log2 mRNA fold difference:-0.58388657086639
Log2 TE fold difference:0.72298790649244
Sequences
Protein sequence

MCTRGHWRPSEDEKLKELVALYGPHNWNAIAEKLQGRSGKSCRLRWFNQLDPRINRSPFS
EEEEELLLASHRVHGNRWAVIARLFPGRTDNAVKNHWHVIMARRCRERMRLSNRRAGGAA
AAGAGAVVVATGAAAEDGSNPRSANKKPRPDASGMASLLDKYRREFSAVPFAINHDSNQQ
QGYCSNTNEDANKSVEFYDFLQVNANSSDTKCGSSIEEQEAESRDDDQAEGQVQFIDFLE
VGASHRRR*

MCTRGHWRPSEDEKLKELVALYGPHNWNAIAEKLQGRSGKSCRLRWFNQLDPRINRSPFS
EQEEALLLASHRVHGNRWAVIARLFPGRTDNAVKNHWHVIMARRCRERMRLSNRGGAAAG
QHGAVDTGAVEDGSNPRNAKKLRPDASSVASFLDKYRREFSVVVPFAINHDRKQQDYCST
TNEADANKSVEFYDFLQVNANSSDTKCGSSIEEQEENRDDQAEGQVQFIDFLEVGVSHPQ
*

Other information
Ka divergence:0.27597KaKs divergence:0.383805
GC content 1 (%):60GC content 2 (%):59GC content divergence:-0.008
Length 1 (bp):747Length 2 (bp):723Length divergence:-0.016
MFE 1 (kcal):-308.8MFE 2 (kcal):-293.9MFE divergence-0.025