Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077293-GRMZM5G832994
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193900
Function (paralog2):hypothetical protein LOC100278855

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.78397296624213
Log2 mRNA fold difference:1.9027909672494
Log2 TE fold difference:-1.1249767272512
Sequences
Protein sequence

MELEADFADEDVSSNNGLQDLWSLDEIDSKRARFPCCIVWTPLPVVSWLAPYIGHVGICQ
EDGAILDFAGSNLVSMDNFAYGSVARYLQLDRKKCCLPVNLAAHVCKQSYSHSEVGAAMS
WDDALQSGMRRFQHKYYNLFTCNCHSFVANCLNRLAYNGSVEWNVLNVASLVWFHGQWVD
KMSFARSFLPFLTVTCIGILMAGWSFLVGMAAFSILLIGWFVFTVYCVKGLIC*

MSPKVLSSMEVEAGFAGDGVGSNNGPQDMWSLGEIDPKRARFPCCIVWTPLPVVSWLAPY
IGHVGICQEDGAVLDFAGSNLVSVDNFAYGSVARYLQLDRKKCCLPVNLAEHVCKQSYNH
SELGAAISWDDALRSSMRRFQHKYYNLFTCNCHSFVASCLNRLAYNGSLEWNVLNVAALV
WFHGRWVDRMSSVRSFLPVLPVTCIGILMAGWSFLLGMAAFSALSDWMVCFHSVLR*

Other information
Ka divergence:0.528754KaKs divergence:-0.113184
GC content 1 (%):45GC content 2 (%):50GC content divergence:0.053
Length 1 (bp):702Length 2 (bp):711Length divergence:0.006
MFE 1 (kcal):-229.02MFE 2 (kcal):-250.6MFE divergence0.045