Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077463-GRMZM2G091558
Species:maize
Duplication type:WGD
Function (paralog1):signal peptidase complex subunit 3
Function (paralog2):hypothetical protein LOC100274280

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.63518524880863
Log2 mRNA fold difference:0.4522414842951
Log2 TE fold difference:0.18698732212614
Sequences
Protein sequence

MHSFGHRANAVATFAVTILAAICFAASFSDNFNTPTPTASVKILNLNWFQKEANGNDEVS
MTLNISADLSSLFTWNTKQVFVFVAAEYETPQNALNQVSLWDGIIPAKEHAKFLIHTTNK
YRFIDQGSNLKGKEFNLTMHWHIMPKTGKMFADKIVMTGYRLPELYR*

MHSFGHRANAVATFAVTILAAMCFAASFSDNFNTLTPTASVKILNINWFQKEANGNDEVS
MTLNISADLSSLFTWNTKQVFVFVAAEYETRQNALNQVSLWDGIIPAKEHAKFLIHTTNK
YRFIDQGSNLKGKEFNLTMHWHIMPKTGKMFADKIVMTGYQLPEQYR*

Other information
Ka divergence:-0.145379KaKs divergence:-0.230866
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):504Length 2 (bp):504Length divergence:0
MFE 1 (kcal):-147.22MFE 2 (kcal):-152.04MFE divergence0.016