Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077612-GRMZM2G456422
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.75635745610625
Log2 mRNA fold difference:-0.53475263958321
Log2 TE fold difference:1.3678843076851
Sequences
Protein sequence

MGGGKSFFCPSIFSFLRKWRRYDDDMADWDGGYARKVRSSDEDYGGWWVGEPDVDRKASD
FINNFHQKN*

MGGKSSFFCPIFSFLRKSRRYEYDDDMSDWDGRTGYVRKVRSSDEDYGGWWVGERDVDSK
ASDFINNFHQKKVAG*

Other information
Ka divergence:-0.771619KaKs divergence:-0.771069
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):210Length 2 (bp):228Length divergence:0.041
MFE 1 (kcal):-80.9MFE 2 (kcal):-83.4MFE divergence0.015