Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077789-GRMZM2G431156
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384757
Function (paralog2):hypothetical protein LOC100384181

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.50188540374731
Log2 mRNA fold difference:-0.18883544026165
Log2 TE fold difference:0.89381729705659
Sequences
Protein sequence

MGRSPCCEKAHTNKGAWTKEEDERLVAYVRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY
LRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARG
IDPKTHRPLGAGADAAAPPGVVAHRALLHRAGAAPVELAVKPAPAESSDDGGRSSASASS
GGGASVEEPRCPDLNLDLSVGPPAAADTPTSQSQLAVCLCYRLGLRAGEACSCQAQADNA
GQQRFRFSDFRTERRVVK*

MGRSPCCEKGHTNKGAWTKEEDERLVAYIRSHGEGCWRSLPSAAGLLRCGKSCRLRWMNY
LRPDLKRGNFTDDEDELIIRLHALLGNKFVSRLPSVDETASFFSVSTFIFSTALPDVTRR
ARRWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARGIDPHAHHRPQALHHVAAAALVPAPA
AKPKPKPAESSDDGGRSSCSCSGSGSSAGEPRCPDLNLDLSVGPPDAPTSPPPPCLCHRA
WEACGCQAG*

Other information
Ka divergence:0.199774KaKs divergence:0.683276
GC content 1 (%):71GC content 2 (%):70GC content divergence:-0.007
Length 1 (bp):777Length 2 (bp):750Length divergence:-0.018
MFE 1 (kcal):-393.1MFE 2 (kcal):-381.4MFE divergence-0.015