Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077809-GRMZM2G065893
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279782
Function (paralog2):hypothetical protein LOC100279516

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGQNHSAQDGSGHGRRSFQQQPSAQWGAGGGGYYAQDPNAGYCGAPVPQQGGGYAAPYLP
PAYQYQPTAAAPAPQVAKPRQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGVDFT
KSNEWTGKFSFHGRSLHHISNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQD
VFCFSPDERPCNGFEEALDRYRELVPHLRLAGPTSFAPIIEMAMTIVEQSGGQYHVLLII
ADGQVTRSVDTASGQLSSQEQKTVDAIVKASELPLSIVLVGVGDGPWDMMKEFDDNIPSR
AFDNFQFVNFSEIMSKNMAQSRKEAAFALSALMEIPQQYKATVELGNLGSRRSSKSPNRV
PLPPPSASHDAYSYSSKSFSKPTTYPQSSSSSSAYPQYGTPHTATPAAPSSTYDNQVCPI
CLVNPKDMAFGCGHQTCCDCGQSLESCPICRTPITTRIKLY*

MGQRQSHSKRDGSSHGRRSRSFQQQPSAQWGAGGGGYYQQDPSTGYYGAPVPQQGGGYYQ
QDPGTGYYGAPVPQQGGGYAAPYRDKPAAAAAVAAPAPQAAKPRQLDRRYSRIADEYHSV
DQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHISNTPNPYEQAISIIGRT
LSKFDEDNLIPCFGFGDASTHDQDVFCFSPDEKPCNGFEEALDRYRELVPHLRLAGPTSF
APIIEMAMTIVEQSGGQYHVLLIIADGQVTRSVDTASGQLSSQEQKTVDAIVKASELPLS
IVLVGVGDGPWDMMKEFDDNIPARAFDNFQFVNFSEIMSKNMAQSRKEAAFALSALMEIP
PQYKATVELGILGRRSFKSPDRVPLPPPSGSHGAYSYYSSKGFSKPSTYPQSSSSSSPYP
HYETPHTATPAAPSATYDNQVCPICLVNPKDMAFGCGHQTCCDCGQILESCPICRTPITT
RIKLY*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):52GC content divergence:0.02
Length 1 (bp):1386Length 2 (bp):1458Length divergence:0.025
MFE 1 (kcal):-462.4MFE 2 (kcal):-520.63MFE divergence0.059