Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077897-GRMZM2G150242
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194103
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.9805526907935
Log2 mRNA fold difference:-2.0571094485804
Log2 TE fold difference:0.037102101864965
Sequences
Protein sequence

MELLDTNGHGKTRAQNAENMAPVSVKSPDTSLEIKEKSPHNLTEHQEELGPPVGHDGSLS
PKILSHIQPTQASDDSSKDEGDHAAVTNKDGVETISENGFTGSNIRPTVEKKSEEDNVYS
HETVAATPKKKVEPVKGSEGSYTGLVDTSAPFESVKEAVTKFGGIVDWKAYRAQSLERRR
VVHLELEKVQQEIPQFKEDWETAEVAKSDVIEELERTNRLVDELKHKLERAQLEVDQAKQ
DSELALLRAQEMEQGIDDDASVIAQTQLAVAKERHEKAVEELKLLKEELRSTHEQYAVLA
TERDAAIKRAEEVVCAAKDTEKQVEELTLELIASKESLELAHASHHEAEEHRLGAAMAKE
QDFLAWEKELEEAQAELNQLNEQIASKRNVESKAHENECKLLGLKSELAAYVENKLNEEA
GMVQEQGSDEAKEISRSIKQALASKRKELAEFKGKLENARIEANLVRVVVESLSSELDRE
KASLATLQQTEGMACITVASLEAELDRTEQEIELVHKKEAETREMMAELPRMLQQAAQEA
DDAKMAAHLAQEELRKAKEEAERTKASATTADTRLRAVLKEIEASKASKGLAIAAVQAMQ
ESNDAGSAGASPRGVTLPISEYHALSKRVHEAEELASERVAAAFAQIELAKESESRNLER
LQEASKEMDEKKSDLQIALERAESANEGKLGAEQELRRWRAEHVQRRKAHEATQHPVSPV
RTPPRMLVEQKGSYREENELPTDPKLHKSNGSMDQFVSSEKSRKKKSFFPQMSTLLSRKA
QTQT*

MELLDSNGHGETRAQGAENIAPVSANSPDTSSEMQGKLPHSLTEHQEEMGSPAGHAGSLS
PKIVSHIEPARASDDPSKDEGRHAALLTDKSGVEIIYENGFTGASSIIPAAEMKSEEDNM
YCRNNVAVTPTKKVESVKGCEGSHTGLVDTSAPFESVKQAVTKFGGIVDWKAYRARSLEV
MSLGFTTYMDHGQTHDHLVLCPSIAATQQFFIFVCMQRRRVMQLELEKVQQEIPQFKEDW
ETAEVAKAHVIEELERTTRLVDELKHELERAQLEVDQAKQDSELALLRAQEMEQGIDDEA
SVIAQTQLAVAKERHEKAVEELELLKEELRSTHEQYAVLATERDVAVKRAKEVVRAAKDT
EKQVEELTLELIASKESLESAHASHHEVEEHRLGAALAKEQDFLAWDKELQEAQEELNQL
HEQIASKTNVEAEAVENERKLLSLKSELAAYVEDKLNEEAGMLQQQGSDEEKEISRSIKQ
ALASKRKELAELKGKLENARNEANLVRVTAESLSSELDREKASLAALQQSEGMASITVSS
LEAELDRTEQEIEMVHKKEAEAREKMAELPRMLQRAAQEAEDAKMAAHSAQEELRKAKEE
VERAKASATTAGTRLRAVSKEIEASKASERLAIAAAQAMQESEDTGSTGASPRVVTLPVS
EYHALSEKVHEAEELANERVAVALAQVELAKVSESRSLERLQEASKETEKKKSDLRIALE
RAERANEGKLGAERELRRWRAEHVQRRKAHEAAQHAVSPVRTPPRMFVQQKGSYLEGNEL
RDPKVHKSTGSMDQFVSDKKSRKKKSFLTQLSTLLSRKTHAQT*

Other information
Ka divergence:0.190452KaKs divergence:-0.00489085
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):2355Length 2 (bp):2472Length divergence:0.024
MFE 1 (kcal):-746.24MFE 2 (kcal):-826.05MFE divergence0.051