Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077942-GRMZM2G147775
Species:maize
Duplication type:WGD
Function (paralog1):actin-depolymerizing factor 5
Function (paralog2):hypothetical protein LOC100280108

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAMAYKMATEGMNVKEECQRWFMEMKWKKVHRFVVYKIDERSRAVLVDKVGGPGEGYEEL
VAALPGDDCRYAVFDFDFVTVDNCQKSKIFFIAWSPAASRIRAKILYATSKQGLRRLLDG
VHYEVQATDPSEMGFDVIRGRAQ*

MRDRIRRQRIPRFRRQGVHPIRDDPQATAMAMAYKMVKPSAPPADHACRRRRRTQPLLCS
REINHACKQPWLMTLCACVCARGFDLQATEGMDVKEECQRWFMEMKWKKVHRFVVYRIDE
RSRAVLVDRVGGPGEGYEELVAALPGDDCRYAVFDFDFVSVDNCQKSKIFFIAWYVRTYE
FLSCSRLQFPVHRLRLRPCPVVCLKEKKPVLSILTSAGRHASHSSQLTTRKLQIQWLFNQ
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):58GC content divergence:-0.049
Length 1 (bp):432Length 2 (bp):723Length divergence:0.252
MFE 1 (kcal):-192.16MFE 2 (kcal):-296.01MFE divergence0.213