Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G077960-GRMZM2G150213
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384560
Function (paralog2):Ca2+/calmodulin-dependent protein kinase phosphatase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.32297369419508
Log2 mRNA fold difference:0.81952541016819
Log2 TE fold difference:-1.1368790710861
Sequences
Protein sequence

MEMHADVDGCSVPLAVLLKRELCNQKVERPDILFGEANKSKKGEDFTLLVPRCHRTPGGS
GGGENAGDDDTISVFAIFDGHNGSAAAIYTRENLISSVLAAIPPNLTSEEWKAALPRALV
AGFVKTDKDFQGKAARSGTTVTFVIIDGWVVTVASVGDSRCILESAEGSIYFLSADHRLD
ANEEEVERVTASGGEVGRINIAGGAGIGPLRCWPGGLCLSRSIGDIDVGEFIVPVPHVKQ
VKLSNAGGRLVIASDGVWDALHFQEALNYTRGLPAEAAANRIVKEAVTSKGLRDDTTCIV
VDILPPEKLSPPLKRPGKGVIKALFRRRPSDEMSEDQMDRGCLETDVVEEIYEEGSAMLA
RRLNINYPEGNMFKLHDCAVCQLEMKPGEGTSVHGNMPKHSRVDPWGGPFLCSSCQLKKE
AMEGKLHSRSMDVFTQML*

MEVHADVDGSGVPLAVLLKRELCNQKVERPDILFGEANKSKKGEDFTLLLPRCHRTTGEG
GGSGGGENAGGGDDDDTISVFAIFDGHNGSLAAIYTRENLINNVLAAIPPNLTSEEWTAA
LPRALVAGFVKTDKDFQTKAARSGTTVTFVIIDGWVVTVASVGDSRCILESAEGSVYFLS
ADHRLDANEEEVERVTASGGEVGRINIAGGAGIGPLRCWPGGLCLSRSIGDIDVGEFIVP
VPHVKQVKLSNAGGRLVIASDGVWDALCFQEALNYIRGLPAEAAANRIVKEAVTSKGLRD
DTTCIVVDILPPEKLSPPLKRPGKGVIKTLFRRRPSDEMSEDQMDRGCLEPDVVEEIYEE
GSAMLARRLNINYPSGNMFKLHDCAVCQLEMKPGEGTSVHGNMPKHSRVDPWGGPFLCSS
CQLKKEAMEGKLHSRNSQFDVRPMPK*

Other information
Ka divergence:0.0862231KaKs divergence:0.058612
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1317Length 2 (bp):1341Length divergence:0.009
MFE 1 (kcal):-453.21MFE 2 (kcal):-463.52MFE divergence0.011