Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G078164-GRMZM2G103595
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217060
Function (paralog2):hypothetical protein LOC100278842

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.508631252649
Log2 mRNA fold difference:-1.825625923418
Log2 TE fold difference:0.32424761516423
Sequences
Protein sequence

MELYVDEKWKFSKKSRNNGSRRVPGSGGGDSLLKRSSSMRDVAAIGRRGTGGAGAAAAGG
CAPQPSFSSRCAGLVKEQRARFYIMRRCVTMLVCWKDCS*

MELYDDEKWKFSKKSRNNGSRRVPGAGAGGGGDSLLKRSSSMRDAPAIGRGAAAGAGGCA
AQQPPSFSSRCAGLVKEQRARFYIMRRCVTMLVCWKDRS*

Other information
Ka divergence:0.539625KaKs divergence:0.467523
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):300Length 2 (bp):300Length divergence:0
MFE 1 (kcal):-161.1MFE 2 (kcal):-153.1MFE divergence-0.025