Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G078174-GRMZM2G150286
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275186
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5482092108012
Log2 mRNA fold difference:-0.89771633647048
Log2 TE fold difference:-0.64763388865398
Sequences
Protein sequence

MAYLSRTAAAVAVAVRSAVRSAPLTGRVLGAPLPSLASPSAARSARILRRTAAAASAGLE
TLMPLHSAVAAARLRSCIVVDSSCWSSLSQGLNKRI*

MASLSRTAAAAVVALRSAVRSAPLTGRVLGAPLPSFASPSATRSARILRRSAAAASAGLE
TLMPLHSAVAAARLRSCIAVDSSCWCSLSQGLNKRI*

Other information
Ka divergence:0.0903687KaKs divergence:0.375563
GC content 1 (%):70GC content 2 (%):69GC content divergence:-0.007
Length 1 (bp):291Length 2 (bp):291Length divergence:0
MFE 1 (kcal):-132.9MFE 2 (kcal):-120.03MFE divergence-0.051