Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G078396-GRMZM2G102230
Species:maize
Duplication type:WGD
Function (paralog1):60S ribosomal protein L23
Function (paralog2):60S ribosomal protein L23

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.13656640941568
Log2 mRNA fold difference:-0.169190072526
Log2 TE fold difference:0.2692953262972
Sequences
Protein sequence

MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP
IGKECADLWPRIASAANAIV*

MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP
IGKECADLWPRIASAANAIV*

Other information
Ka divergence:0KaKs divergence:0.999931
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):423Length 2 (bp):423Length divergence:0
MFE 1 (kcal):-155MFE 2 (kcal):-148.8MFE divergence-0.02