Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G078500-GRMZM2G092817
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC100280732

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.69341394994838
Log2 mRNA fold difference:-1.6222484752438
Log2 TE fold difference:0.93114980006844
Sequences
Protein sequence

MGQSQGRAGRAKPETRHATREGEQQRRRGDIARPGPEATAEEGQQRRPPRVPATMDTFFL
SHGSPTLSIDDSIPARHFFKSWVPAKVAGDQPPRAILVVSGHWETATPAVNVIRGSNDTI
YDFYGFPKPMYQLKYPAPGAPDLALRTVELLEQAGFGPVKQDHSRGLDHGAWVPLMLMYP
DASIPVCQLSVQTDRDGTYHYNLGKALAPLREEGTLIIGSGSATHNLRKISPSDAPVPQW
AAEFDTWLKDSLLNGRYEDVKRYEEKAPHARVAHPWPDHFYPLHVALGAAGDGAKAEQIH
QCWSNGTLSYASYRFTTNT*

MFLRRPSKHPIHSLSLLCSPRTTGHHHKPDATHARKIIRRSQGGGKPETRHATREGEEQR
QRGRGDTARTERDAAAEEGQRRAPPRVPATMDTFFLSHGSPTLSIDDNIPARHFFKSWVP
AKVAGDQPPRAILVVSGHWDTATPEVNVIRGSNDTIYDFYGFPKPMYKLKYPAPGAPDLA
LRTKGLLEQAGFGPVKEDHSRGLDHGAWVPLMLMYPDADIPVCQLSVQSDRDGAYHYSLG
RALAPLREEGVLVLGSGSATHNLRKMGPFDAPVPQWAAEFDAWLKDSLLDGRYEDVNRFE
EKAPHGRVAHPWPDHFYPLHVALGAAGDGAKAEQIHQCWTNATLSYASYRFTTKS*

Other information
Ka divergence:0.403718KaKs divergence:-0.386493
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):960Length 2 (bp):1068Length divergence:0.053
MFE 1 (kcal):-437.3MFE 2 (kcal):-505.32MFE divergence0.072