Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G078541-GRMZM2G150212
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382125

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.12669371745709
Log2 mRNA fold difference:0.341583898758
Log2 TE fold difference:-0.23938560954563
Sequences
Protein sequence

MQSSGIWKAHAGSSQSEGSGLDMERNGCNHNYCPSPLQPIASAGQHSESSAAYFSWPTST
LMHGSAEGRANYFGNLQKGVLPGHLGRLPKGQQATTLLDLMIIRAFHSKILRRFSLGTAI
GFRIRKGTLTDTPAILVFVARKVHRKWLSATQCLPTALEGPGGVWCDVDVVEFSYYGAPA
PTPKEQLYDELVDGLRGSDPIVGSGSQVASLETYGTLGAIVKSQTGNKQVGFLTNRHVAV
DLDYPNQKMFHPLPPNLGPGVYLGAVERATSFITDDVWYGIYAGTNPETFVRADGAFIPF
ADDFDITSVSTSVKGVGVIGDVKAIDLQSSIGSLIGRQVVKVGRSSGLTTGTVVAYALEY
NDEKGICFFTDFLVVGENQQTFDLEGDSGSLIILTGQDGEKPQPIGIIWGGTANRGRLKL
KSGQGPENWTSGVDLGRLLDLLELDLITTSEGLQAALEEQRITLAAAAAAATNSTATESS
PVAGPQENDKIDKIYEPLGINIIPRDSSSISTDQPNENVEELNLMSPMRNGQEGNGDLNN
LMDLELENSPDGICIALNLGEREPKRLRSDFDSTLDMDLQK*

MQPSDIWKAHAGSSQSEASGLDMERNGCNHNCCPSPLQPIASAGQHSESSAAYFSWPTST
LMHGSAEGRANYFGNLQKGVLPGHLGRLPNGQQATTLLDLMIIRAFHSKILRRFSLGTAI
GFRIRKGTLTDTPAILVFVARKVHRKWLSPTQCLPGALEGPGGVWCDVDVVEFSYYGAPA
PTPKEQLYDELVDGLRGSDPSIGSGSQVASLETYGTLGAIVKSRTGNKQVGFLTNRHVAV
DLDYPNQKMFHPLPPNLGPGVYLGAVERATSFITDDVWYGIYAGTNPETFVRADGAFIPF
ADDFEIASVSTSVKGVGVIGNVKAIDLQSPIGSLIGRQVVKVGRSSGMTTGTVVAYALEY
NDEKGICFFTDFLVVGENQQTFDLEGDSGSLIILTGQDGEKPQPIGIIWGGTANRGRLKL
KSGQGPENWTSGVDLGRLLDLLELDLITTSEGLQAALEEQRITLAAAAAAATNSTATESS
PVAGPQEDDKIDKIYEPLGINIIPRDGSAISTDQPNEDVEELNLMSPMRNGEEGNGDFNN
LMDLESENSPDGISIALNLGEREPERLRSVSDSMLDIDLQK*

Other information
Ka divergence:0.25053KaKs divergence:0.56422
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1746Length 2 (bp):1746Length divergence:0
MFE 1 (kcal):-578.35MFE 2 (kcal):-591.94MFE divergence0.012