Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G078826-GRMZM2G077125
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383248
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSGGTGSSGRAAPRYAPDDPTLPKPWRGLVDGTTGYLYYWNPETNVTQYERPVPPESQLL
PPPPPLPPPPPRSRDRRDRSRSRSRTPPRRDHRDRDRDRDRRHDEHASSKTASSHHHPAP
VAVADDPSTEAYRRRHEITVTGDNVPTPITSFEAGGFPSEILKEIQRAGFASPTPIQAQS
WPIAMQNQDVVAIAKTGSGKTLGYLLPGFMHIKRLQNSTRNGPTVLVLAPTRELATQILD
EAVKFGRSSRISCTCLYGGAPKGPQLRDLDRGVDVVVATPGRLNDILEMRKVSLKQVSYL
VLDEADRMLDMGFEPQIRKIVKEIPHRRQTLMYTATWPKEVRRIADDLLVHPVQVTIGSV
DSLVANSSITQHVEIITPSEKQRRLEQILRSQDSGSKILIFCTTKRMCDQLARTLTRQFG
ASAIHGDKSQSEREKVLNQFRSGRSPILVATDVAARGLDIKDIRVVINYDFPTGVEDYVH
RIGRTGRAGATGVAYTFFCDQDSKYAADLIKILEGANQRVPRDLEDMASRGGGRGRKRNH
WASRPDRGGSRSELDSRYSSRDGLASSGKSESGRGSRGRDDNGSRGRYDPGETDGRSRRS
TRGRSRSRSKSDSRSRSPSPKKSRRHEGRRSRTKSRSRSRSRRNHGASHSKSRSPVASRR
YEKTASGSARPNSGHAEHKSPPRSHSRDDHVNHSDHKDDHKDDHMEDGKMERVDLDRSPS
PHDDKSAPYSPVYNGKASGSMSPNGQPEAGAKFVEPSGKPEPASPVRCSKGRDDDEEGII
DEDGEIGEDDPRANAAVQNGNN*

MSGASGSTGRAAPRYAPDDLTLLKPWRGLVDGTTGYLYYWNPETNVTQYERPMPPENQLP
PPPPPLPPPPPRSRDRRDRSRSRSRTPPRRDRRDRDRDDEHASSKTASSHHHPAPIAVAD
YPSTEAYRRRHEITVTGDNVPAPITSFEAGGFPSEILKEIQRAGFASPTPIQAQSWPIAM
QNQDVVAIAKTGSGKTLGYLLPGFMHIKRLQNSTRNGPTVLVLAPTRELATQILDEAMKF
GRSSRISCTCLYGGAPKGPQLRDLDRGVDVVVATPGRLNDILEMRRVSLKQVSYLVLDEA
DRMLDMGFEPQIRKIVKEIPHRRQTLMYTATWPKEVRRIADDLLVHPLQVTIGNVDELVA
NSAITQHIEVITPSEKQRRLEQILRSQVSGSKILIFCTTKRMCDQLARTLTRQFGASAIH
GDKSQSEREKVLNHFRSGRSPILVATDVAARGLDIKDIRVVINYDFPTGVEDYVHRIGRT
GRAGATGVAYTFFCDQDSKYAADLIKILEGANQQVPRDLEDMASRGGGRGKKRNRWASRS
ERGGPRSELDSRYSGRDGLASSGRSESGRGSHGRDDYGSRGRYDSGETDGRSRRSARGRS
RSRSPSPKRSHHHEARRSRSRSRSRSCRNFRASRSKSHSPVASSRHEKAAVISGSTQPNL
GYAEHKSPPRSHSGDDHVNHPDQKDDHMGDGKMERVDLDRSPSPQYDKSAPYSPAYNGKA
SDSMSPNVQPKADAKYVKPSGKPEPASPLRHSKGRDDDEGIIDDDGEIAEGEMMMKVS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):2409Length 2 (bp):2337Length divergence:-0.015
MFE 1 (kcal):-852.74MFE 2 (kcal):-813.63MFE divergence-0.023