Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079123-GRMZM2G111117
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):P-type R2R3 Myb protein Fragment

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7563723566773
Log2 mRNA fold difference:-2.9080383441007
Log2 TE fold difference:1.2602291619538
Sequences
Protein sequence

MGRSPCCEKIGLKKGPWTPEEDQKLLAYIQEHGHGSWRALPVKAGEYSTIFPMNIVREIS
TNSLAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPNR
TDNEIKNYWNTHLKKRLAKMGIDPVTHKSISGTRIGTTNDKSTKAAASLSHMAQWESARL
EAEARLARESKIRTATPTPTALHAQPTILPASAASPCLDVLHAWQGAKIDLESPTSTLTF
TGSNSGTLPTPRTNRLDVSESNCAVWHQRSDDLEDEENDWQIFSKHQLLELDSKEREEDF
IGCEEPWFSEMAGVGAGFTGMLLGVSNEHDASECWGESNNGQTERSNQASDEEDKNYWNG
VLDMVNSELTPKSPPFV*

MGRSPCCEKIGLKKGPWTPEEDEKLLAFVEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY
LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPNRTDNEIKNHWNTHLKKRLAKIG
IDPVTHKSTCGTLTGTTNDRSAKAAASLSHMAQWENARLEAEARLARESKTRTATPTPSA
LHAQPMDLPASAASPWLDVLHAWQGAKIDLESPTSTLTFTGSNGGMLPTPRTNGPEVSES
NSAMSHYQMSDELEGEETYWQIFSKHQVPEVDSKESEDDFIGCEEPWFSGMAGVGAGMLL
DVSNEHELSECWGESSSGQTVEHSKQASDKEDKDYWNWVLDRVNSELTAQSPSLV*

Other information
Ka divergence:0.274275KaKs divergence:0.436808
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):1134Length 2 (bp):1068Length divergence:-0.03
MFE 1 (kcal):-387.2MFE 2 (kcal):-386.22MFE divergence-0.001