Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079196-GRMZM2G132804
Species:maize
Duplication type:WGD
Function (paralog1):COP9 signalosome complex subunit 2
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.57726920800679
Log2 mRNA fold difference:0.60568623915546
Log2 TE fold difference:0.056239045223703
Sequences
Protein sequence

MGSDADMEDYGFEYSDEEPEEQDVDIENQYYNSKGLVETDPEGALAGFDQVVSMEPEKAE
WGFKALKQTVKLYYKLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQN
FTLLQEFYQTTLKALEEAKNERLWFKTNLKLCKIWFDIGEYGRMSKILKELHKSCQREDG
SDDQKKGTQLLEVYAIEIQMYTETKNNKKLKELYQRALSIKSAIPHPRIMGIIRECGGKM
HMAERQWAEAATDFFEAFKNYDEAGNPRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKN
DPEILAMTNLIAAYQKNDIMEFEKILKSNRRTIMDDPFIRNYIEDLLKNIRTQVLLKLIK
PYTRIRIPFISQELNFPEKDVEQLLVSLILDNRIQGHIDQVNKLLERGERSKGMRKYNAI
DKWNTQLKSIYQTLSNRV*

MGSDADMEDYGFEYSDEEPEEQDVDIENQYYNSKGLVETDPEGALAGFDQVVSMEPEKAE
WGFKALKQTVKLYYKLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQN
FSLLQEFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDG
SDDQKKGTQLLEVYAIEIQMYTETKNNKKLKELYQRALSIKSAIPHPRIMGIIRECGGKM
HMAERQWDEAATDFFEAFKNYDEAGNPRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKN
DSEILAMTNLIAAYQKNDIMEFEKILKSNRRTIMDDPFIRNYIEDLLKNIRTQVLLKLIK
PYTRIRIPFISQELNFPEKDVEQLLVSLILDNRIQGHIDQVNKLLERGERSKGMRKYNAI
DKWNTQLKSIYQTLSNRV*

www.000webhost.com

Other information
Ka divergence:0.0021645KaKs divergence:0.452381
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1317Length 2 (bp):1317Length divergence:0
MFE 1 (kcal):-353.19MFE 2 (kcal):-367.76MFE divergence0.02