Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079436-GRMZM2G079491
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100383195

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.1966318266162
Log2 mRNA fold difference:-0.81741993310437
Log2 TE fold difference:1.0275782513793
Sequences
Protein sequence

MGDSTSTGFAAALELWQEHQLSILVVASLAIQWFLFVFAPLRQHRIPGLLRLSIWLAYLG
SDAVAIYALATLFNSHRCDTDTGRPGVELLWAPILLVHLGGQDSITAYNIEDNELWRRHV
VTAVSQVAAAIYVFVKAWPKSLVTTAHQAVNQATLDKVNAIQAHNEEMEAYGRIFTPALL
LFFCGITKCVFKPWDLKRVSVNSLVDSSSGSEEKGGESEMNSLQGYVGAATRYFESRGHG
RGAGLQEDDGDDDTCKAGEVWKPYNLCVDLAPPYSGRLSCLKHLARSPADEAHRLVKSSL
SATFHQLYTKESLKLHDISHFVFTNNAALNRWKVLTSARGLRTVAAATLLGAIAVFHYGG
GAADQVKADVTVTYALLWSAFVMEYVLPTVIHHTFGRVQRLFTGHRTWPDQVAQYNLMGY
VARRRKHSWLMEVVGWLGCRDLVDQLWTMDPCKGASSREITGLVHGHVAGGWMEGHIAGA
DSFRAFNDYRGQWTLNNSSVPSMVLMSVSRPFDESVLVWHLATDFCFHLLQEDPSPSSAT
ARRCREMSNYMAYLLFVKPEMLMPGARRSLFRDTCGELVGLLGEDRPGAPRARGKRGLAH
KVVQLLKRDDGGGVLGSAGVGVVRRAWCVAEDLMDSHRGSEEKMWAVIQGVWVEMLCFSA
SRCKGYLHAKGLGTGGEYLSYVWLLLLYMGMETLAEKMQRTELYEGPTAAASSISGHNV*

MSESESSNTAGFAAALELWQENQLRILVLISLATQCFLFVFAPLRQHRIPGPLRLSIWLA
YLGSDAVAIYALATLFNSHRCDTGTGTGTARAGVELLWAPIMLVHLGGQDSIPAYNIEDN
ELWRRHVVTAVSQVAAAIYVFVKSWPKSMAATAAHLVVDQDTRNRINAFMAHKSEMAAYG
RILGPALLLFFSGITKCVCKPWDLKRVSVNSLVDSSSSGSSEEKGDAGESEMMDSLQEYV
GAAAQYFESVGHEEEEEDDDAACKADEVWKPYNLCVDLAPPYSGRLSCLKHLARSPADEA
HRLVKSSLSATFHQLYTKESLKLHDMSHIVLTDNRALNRLKLVTSARGLRTVAAATLLGA
IAAFYGEGDVDQDPTDVTITYALLWSAFVMECVLPTVIHHTFAWIERLFTGHRTWPDQVA
QYSLMGYVARGRSHSWLMKAVACLGCGDLVDQLWTMKPRMGASSREITGLVHAHVAGAWM
QGHIAGADSFRAFNDYRGQWTLGNCREIGVGVSSSMVVLMSSVSRPFDESVLVWHLATDF
CFHLLQVQGDPSRANATARRCIEMSNYMAYLLFVKPEMLMPGARRKLFRDACRELVGLLE
EDRPDAPRARGKRDLAHKVVQLLKRDGDDVLGSAGVGVVRRAWCVAEKLVDSHSGDEEKM
WTVIQGVWVEMLCFSASRCKGYLHAKGLGTGGEYLSYVWLLLLYMGMETLAEKMQRTELY
EGSTAAALSISGQNV*

Other information
Ka divergence:0.352878KaKs divergence:0.187146
GC content 1 (%):63GC content 2 (%):63GC content divergence:0
Length 1 (bp):2160Length 2 (bp):2208Length divergence:0.011
MFE 1 (kcal):-975.65MFE 2 (kcal):-1011.1MFE divergence0.018