Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079632-GRMZM2G162739
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273749
Function (paralog2):hypothetical protein LOC100280247

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5094223388909
Log2 mRNA fold difference:-2.708757640059
Log2 TE fold difference:1.2132771603226
Sequences
Protein sequence

MVAMAAVQQQQQQQRRDAEAELNLPPGFRFHPTDEELVAHYLCARAAGRRPPVSIIAEVD
LYRFDPWDLPERALFGRREWYFFTPRDRKYPNGSRPNRAAGSGYWKATGADKPVEHEGRT
AGIKKALVFYHGKPPRGVKTEWIMHEYRLAEAGGARAKKSGAGTLRLDDWVLCRLYNKKN
EWEKMQQQKEKEKKAMESEASLSHSHSDTRTPESEIDDDPFPELGSLPAFDDMGAAPAPA
GVVLPKEEVEDFGDLGGDDWLAGINLDDLQMPGDAADFYGSMLVSPMAAKMEPDGGFPFF
*

MVMAPAAAQQQRRRDAEAELNLPPGFRFHPTDEELVAHYLCARAAGRRPPVSIIAEVDLY
RFDPWDLPERALFGRREWYFFTPRDRKYPNGSRPNRAAGSGYWKATGADKPVEHGGRTVG
VKKALVFYHGKPPRGVKTEWIMHEYRLADAGARARARKPGTGTLRLDDWVLCRLYNKKNE
WEKTQQQQEKKQNQKQMESEASLSHSHSDTRTPESEIDDDPFPELASLPALDDMMGPAAA
APAGAILPKEEVEDLGGLGGDDWLAGINLDDLQIPGEADFYGSMLVSPMAAKMEQDAAGF
PFF*

Other information
Ka divergence:-0.0338457KaKs divergence:0.210559
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):903Length 2 (bp):912Length divergence:0.005
MFE 1 (kcal):-449.71MFE 2 (kcal):-440.1MFE divergence-0.011