Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079645-GRMZM2G144606
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.60296776951056
Log2 mRNA fold difference:-0.19439290293171
Log2 TE fold difference:-0.40347664976128
Sequences
Protein sequence

MVTLENLRRIYGHVVERATLARDLLAPAAGQLSGNLHSRCILAQQLDLSFPEKDDDLRAD
LEKFGAIEAIALCRHLFMAVIVFRDEASVPVAFRRQEEISSGLYSAVPPPHLALSTSFIH
PNSIKVNLYSNTSTASSGDSTAKHSTEPTTTEAATSIGQSMMPLWMESRPATVFQNYLGD
GSRFVPSRRSQIYGPTLGADGRLWMEGFNIVQCGNYAQSVPTAIPVAQVPQLLYQSEDEL
AARRTRSHITISSSVGSPINPLQRSPIRATPLRVGSYPRSTEVSVCTAVNIGSAFPAIMI
TTRK*

MVTLENLRRIYGHVVERATLARDLLAPAVGQLSGNLHSRCILAQQLDLSFPEKDDDLRAD
LEKFGAIEAIALCRHLFMAVIVFRDEASVPVAFRRQEEISSGLYSAVPPPHLALSTSFIH
PNSIKVNLYSNTSTASSGDSTAKHSTEPTTTEAATSIGQSMMPLWMESRPATVFQNYLGD
GSRFVPSRRSQIYGPTLGADGRLWMEGFNIVQCGNYAQSVPTAIPVAQVPQLLYQSEDEL
AARRTRSHITISSSVGSPINPLQRSPIRATPLRVGSYPRSTEVSVCTAVNIGSAFPAIMI
TTRK*

Other information
Ka divergence:1KaKs divergence:-0.654489
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):915Length 2 (bp):915Length divergence:0
MFE 1 (kcal):-310.74MFE 2 (kcal):-309.94MFE divergence-0.001