Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079653-GRMZM2G146028
Species:maize
Duplication type:WGD
Function (paralog1):ethylene-responsive transcription factor 3
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.45897077935805
Log2 mRNA fold difference:-0.80271763074151
Log2 TE fold difference:1.2791141297727
Sequences
Protein sequence

MRRRGVAAAEADGDVELRFRGVRKRPWGRYAAEIRDPAKKARVWLGTFDSAEDAARAYDA
AARMLRGPKARTNFPLPAAAALHHHHMPAAAAAAAPPYTTYPTATGVSTPPVARPACSSL
SSTVESFSGARPRPVLPPRFPPPSIPDGDCRSDCGSSASVVDDDCTDAAASASCPFPLPF
DLNLPPGSGGGAGVGFYADEEDELRLTALRL*

MRRGGVAAAAADGDVESRFRGVRKRPWGRYAAEIRDPAKKARVWLGTFDSAEDAARAYDA
AARMLRGPKARTNFPHPAAHHHHLLHMPAAAAAPYTTPTATGVSTPPVPRPACSSLSSTV
ESFSGARPRPVLPPRPPPPPITDVDCRSDCGSSASVVDDDCTDAAASPSCPSPLPFDLNL
PPSGGGCGAGVGSYADEEGELRLTALRL*

Other information
Ka divergence:0.138664KaKs divergence:0.621958
GC content 1 (%):72GC content 2 (%):73GC content divergence:0.007
Length 1 (bp):636Length 2 (bp):627Length divergence:-0.007
MFE 1 (kcal):-342.39MFE 2 (kcal):-327.67MFE divergence-0.022