Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079668-GRMZM2G111475
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280354
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.2107790514213
Log2 mRNA fold difference:-3.9993754774153
Log2 TE fold difference:1.7967983807162
Sequences
Protein sequence

MATTTFPTSTPFFAAHHGPRRSRPSISAAVYARGRRWRPLRVACEKVVGIDLGTTNSAVA
AMEGGKPTIVTNAEGARTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKM
NEVDEESKQVSYLVIRDDNGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASKFLNDKVTK
AVITVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNETILVFDLGGG
TFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWLAGNFKNDEGIDLLKDKQALQRL
TEAAEKAKMELSSLTQTNMSLPFITATADGPKHIETTLTRAKFEELCSDLLDRLRTPVDN
ALRDAKLQFKDIDEVILVGGSTRIPAVQELVKKMTGKDPNVTVNPDEVVALGAAVQAGVL
SGDVSDIVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQ
GEREFVRDNKSIGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITIT
GASTLPKDEVERMVGEAEKFAKEDKEKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVK
GKVESKLQELKDAVAGGSTQTMKDAMSALNQEVMQIGQALYSQQGAPGAGPGAADASSAG
SAGTSEKPGDGGDVIDADFTDSK*

MATTTFPTSTPFFAAHHGPRRSRPSISAAVYSRSRRWRPLRVACEKVVGIDLGTTNSAVA
AMEGGKPTIVTNAEGARTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKM
NEVDEESKQVSYRVIRDDNGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASKFLNDKVTK
AVITVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNETILVFDLGGG
TFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWLAGNFKNDEGIDLLKDKQALQRL
TEAAEKAKMELSSLTQTNISLPFITATADGPKHIETTLTRAKFEELCSDLLDRLRTPVDN
ALRDAKLQFKDIDEVILVGGSTRIPAVQELVKKMTGKDPNVTVNPDEVVALGAAVQAGVL
SGDVSDIVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQ
GEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAVDKGTGKKQDITIT
GASTLPKDEVERMVDEAEKFAKEDKEKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVK
GKVESKLQELKDAVAGGSTQTMKDAISALNQEVMQIGQSLYSQQGAPGAGPGPADASAGS
AAGTSEKPGDDGDVIDADFTDSK*

Other information
Ka divergence:-0.55463KaKs divergence:-0.40367
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):2052Length 2 (bp):2052Length divergence:0
MFE 1 (kcal):-767.16MFE 2 (kcal):-762.37MFE divergence-0.003