Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079683-GRMZM2G306643
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276955
Function (paralog2):hypothetical protein LOC100278004

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-3.8256016643631
Log2 mRNA fold difference:-5.7806313036439
Log2 TE fold difference:1.7745060452448
Sequences
Protein sequence

MAGSARSAAAKHAYRMFVAPSRGGAAARGPGAGAAEEFDESDVWGSFGADSQYSSPGAEL
GAGWARPIPGSGARRKKPVDGGGGGGAAGSLPMNIPDWQKILGVEYRDHHRAGEWEPGAD
DDDDDDGSSYGRARGGAEMVPPHELAWRSRAASLSVHEGIGRTLKGRDLSRVRDAVWKKT
GFED*

MAGSARSAAAKHAYRMFAPPSMGASAGAGAGVGGAEELDEADVWGSFGAACHSSAVSSDD
LAGAAGWARPVHGPRAGRKKPVDGGGGAVGSLPMNIPDWQKILGVEYRDHQHAGEWEADA
DDGGGGGGSYGGAEMVPPHELAWRSRAASLSVHEGVGRTLKGRDLSRVRDAVWKRTGFED
*

Other information
Ka divergence:0.630702KaKs divergence:-0.584799
GC content 1 (%):76GC content 2 (%):77GC content divergence:0.007
Length 1 (bp):555Length 2 (bp):543Length divergence:-0.011
MFE 1 (kcal):-319.7MFE 2 (kcal):-318.6MFE divergence-0.002