Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079915-GRMZM2G301208
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191958
Function (paralog2):hypothetical protein LOC100277200

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.26104392137924
Log2 mRNA fold difference:-0.60779363127667
Log2 TE fold difference:0.28030221420143
Sequences
Protein sequence

MQAVARARGLAAAAVAARPSAMEAGHRGQVQQARGIVVQVRDGNLERALAVMERKMRSSG
MERLIRARTHYHVKDSEKRVLARKALMQRVRSQELGKKLREILIKKIRGQ*

MVTIVPGRLDPTSRIESDAPSSVCGGGGRRRKRNMQAVARAARGLAAAAAAAAARPSATE
AGHRGQVQQARGIVVQVRDGNLERALSIMERKMRSSGMERLIRARTHHHVKDSEKRVLAR
KGLMQRVRSQELGKKLREILIKKIRGQ*

Other information
Ka divergence:-0.129646KaKs divergence:0.326103
GC content 1 (%):67GC content 2 (%):66GC content divergence:-0.008
Length 1 (bp):333Length 2 (bp):444Length divergence:0.143
MFE 1 (kcal):-159.6MFE 2 (kcal):-212.2MFE divergence0.141