Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079956-GRMZM2G157481
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384516
Function (paralog2):protein binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MMRANREQRVAFSSTKEAAAVPKEEVWEVRPGGMLVQKRSPDADPPPGGAPVPTIRVKVK
FNGVYHEIYINSQASFGNNASSSVLRLCMCCSCFFLLSEFEPVNACSCRRAQEAAVGEDG
PAPGRPEGGVQGQGEGLQGVPGHGRRQGPLQDGHARGPRRQGQAPPRGAPDRQGRARRQG
HRPRRPRRRQARNQGVGAGDDREQGRQGRGRGRGDADRGADERAGEAGLRRRRRGGEGGA
AGAGEAGAEVRGDAGRHPRQEQGGGGGGAGQGPQRQQQGAAAAPAPGFGARASEPAAAPA
VPAAGAGVADPDGELGDVRPPVVSAVDVGGPRDDHGPRDQHHAVPALRLGALLDGSSR

MMMSGNRKQRVALSPVKEAAAVPKEEVWEVRPGGMLVQKRSPDADPPPVPTIRVKVKFNG
VYHEIYINSQASFGELKKLVSEKTGLHPDDQKVVYKDKERDSKAFLDMAGVKDRSKMVML
EDPAAKAKRLLEERRTSKAERAAKAIARVALDVDKLATKVRVHPSVVATRSTSRPRWLMG
RLVTLSGLSLDRQVSALETVASKGGKVVDADVATLTEALMRELVELDSIAADGDAKAQRR
AQERRVQRHVETLDAIRAKNKAAAPSSNRTRRPAHLPPRPQNQQRRQFQPPAPTTATAPA
PQTQTAASWDSFDLLSSVPPSTSAAAPVTSTTTPSPRLEWELF*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):68GC content 2 (%):69GC content divergence:0.007
Length 1 (bp):1074Length 2 (bp):1032Length divergence:-0.02
MFE 1 (kcal):-513.24MFE 2 (kcal):-508.71MFE divergence-0.004