Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G079957-GRMZM2G167794
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384587
Function (paralog2):hypothetical protein LOC100192924

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:3.0739891984254
Log2 mRNA fold difference:0.32659125765534
Log2 TE fold difference:2.7501724027954
Sequences
Protein sequence

MEVAAAASYSYYGLEAADDDVDNLRATELRLGLPGTEAAEEEEEARQAQKVAAPPPSTPR
GKKRDGVSGGIDAAPPAAKAQVVGWPPVRSYRKSCFQQQQAGAKGKPAAADEGAPGPAGG
GVFVKVSMDGAPYLRKVDLGTCGGYRQLREALEAMFLCFSGPGSGDASGGGGGGSPSDFA
VTYEDKDGDLMLVGDVPFSMFIGTCKRLRIMKGSEARLGLGSAKNND*

MEVAAASAASYGFKADDDVDSLRATELRLGLPGTEEKEEAEEPQHKAAPPPPSTPRGKKR
DVVASSGPEDAPKKRDCETDADADAAPPPAAKAQLVGWPPVRSYRKSCFQQQAAAKNKPA
AALAEEAPAAGGLFVKVSMDGAPYLRKVDLKMYKGYRELREALEAMFLCFSGAADAPAVN
PSDFAVTYEDKDGDLMLVGDVPFGMFISTCKRLRIMKGSEARGLGSAKNN*

Other information
Ka divergence:-0.641314KaKs divergence:-0.371591
GC content 1 (%):71GC content 2 (%):69GC content divergence:-0.014
Length 1 (bp):684Length 2 (bp):693Length divergence:0.007
MFE 1 (kcal):-364.6MFE 2 (kcal):-340.3MFE divergence-0.034