Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G080048-GRMZM2G030646
Species:maize
Duplication type:WGD
Function (paralog1):Eukaryotic translation initiation factor 2 beta subunitPutative uncharacterized protein ;
Function (paralog2):hypothetical protein LOC100193916

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MADEEHSERREEASELAPFDPTKKKKKKKVVIQEPSDEVDKLAEKTETLAVAEPAELNFT
GMKKKKKKPVDLDSTLDELGDGEDTQDDQAVEEQGEGIVLGSVPTYPWEGTDRDYKYEEL
LDRVFNILRENNPDLAGDRRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPEHVMMFL
LAEMGTSGSLDGQQRLVIKGRFAPKNFEAILRRYINEYVICNGCKSPDTILSKENRLFFL
RCEQCGSSRSVAPIKAGFVAQVGRRKA*

MADEEHPERREEASELAPFDPTKKKKKKKVVIQEPSDEVDKLAEKTESLAVAEPAELNFT
GMKKKKKKQVDLDSSIDDLGDGEDTQGDQVVEEQGDGIVLGGGPTYPWEGTDRDYKYEEL
LDRVFNILRENNPDLAGDRRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPEHVMMFL
LAEMGTSGSLDGQQRLVIKGRFAPKNFEAILRRYINEYVICNGCKSPDTILSKENRLFFL
RCEQCGSSRSVAPIKAGFVAQVGRRKA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):804Length 2 (bp):804Length divergence:0
MFE 1 (kcal):-252.66MFE 2 (kcal):-260.9MFE divergence0.016